Proteintech, 83236-2-RR, TDO2 Recombinant monoclonal antibody

Size: 20ul / 100ul The TDO2 (83236-2-RR) by Proteintech is a Recombinant antibody targeting TDO2 in WB, ELISA applications with reactivity to human, rat samples 83236-2-RR targets TDO2 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TDO2 (tryptophan 2,3-dioxygenase), IDO1 (indoleamine 2,3-dioxygenase 1) and IDO2 are three enzymes that catalyze the amino acid tryptophan into kynurenine in the kynurenine pathway (PMID: 23090118, 28469468). TDO2 plays an important role in neurological diseases such as Alzheimer's disease, Parkinson's disease and autism. Overexpression of TDO2 promoted tumor cell survival and was correlated with tumor grade and poor prognosis in triple negative breast cancer, brain tumors and esophageal squamous cell carcinoma. TDO2 may be a potential therapeutic target in some cancers. (PMID: 21976023, 30134247) Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8531 Product name: Recombinant human TDO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 55-406 aa of BC005355 Sequence: QELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD Predict reactive species Full Name: tryptophan 2,3-dioxygenase Calculated Molecular Weight: 406 aa, 48 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC005355 Gene Symbol: TDO2 Gene ID (NCBI): 6999 RRID: AB_3670913 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P48775 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.