Iright
BRAND / VENDOR: Proteintech

Proteintech, 83249-3-RR, ABHD6 Recombinant monoclonal antibody

CATALOG NUMBER: 83249-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ABHD6 (83249-3-RR) by Proteintech is a Recombinant antibody targeting ABHD6 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 83249-3-RR targets ABHD6 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, THP-1 cells, COLO 320 cells, C6 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ABHD6 (α/β-hydrolase domain-containing 6) belongs to the α/β-hydrolase fold superfamily and was originally discovered in a functional proteomic approach designed to discover monoacylglycerol (MAG) hydrolases in the mouse brain degrading the endocannabinoid 2-arachidonoylglycerol. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13968 Product name: Recombinant human ABHD6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 29-337 aa of BC001698 Sequence: LWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD Predict reactive species Full Name: abhydrolase domain containing 6 Calculated Molecular Weight: 337 aa, 38 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC001698 Gene Symbol: ABHD6 Gene ID (NCBI): 57406 RRID: AB_3670924 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9BV23 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924