Product Description
Size: 20ul / 100ul
The NRG1, isoform Alpha (83251-2-RR) by Proteintech is a Recombinant antibody targeting NRG1, isoform Alpha in IF/ICC, IF-P, ELISA applications with reactivity to human samples
83251-2-RR targets NRG1, isoform Alpha in IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive IF-P detected in: rat brain tissue
Positive IF/ICC detected in: MCF-7 cells
Recommended dilution
Immunofluorescence (IF)-P: IF-P : 1:250-1:1000
Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500
Background Information
Neuregulin 1 (NRG1) is a trophic factor that has been implicated in neural development, neurotransmission, and synaptic plasticity. NRG1 has multiple isoforms that are generated by usage of different promoters and alternative splicing of a single gene. NRG1 and its receptor ErbB tyrosine kinase are expressed not only in the developing nervous system, but also in the adult brain. The immunogen of this antibody is against NRG1 isoform Alpha.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag35114 Product name: Recombinant human NRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 177-241 aa of BC007675 Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK Predict reactive species
Full Name: neuregulin 1
Calculated Molecular Weight: 70 kDa
Observed Molecular Weight: 70 kDa
GenBank Accession Number: BC007675
Gene Symbol: NRG1
Gene ID (NCBI): 3084
RRID: AB_3670926
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q02297
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924