Proteintech, 83275-2-RR, EPB41L3 Recombinant monoclonal antibody

Size: 20ul / 100ul The EPB41L3 (83275-2-RR) by Proteintech is a Recombinant antibody targeting EPB41L3 in WB, FC (Intra), ELISA applications with reactivity to human samples 83275-2-RR targets EPB41L3 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information EPB41L3, also known as 4.1B and DAL1, belongs to the protein 4.1 family. It is a tumor suppressor that inhibits cell proliferation and promotes apoptosis. EPB41L3 modulates the activity of protein arginine N-methyltransferases, including PRMT3 and PRMT5 (PMID: 15334060, 15737618). DAL1 loss is an early event in meningioma tumorigenesis (PMID: 10888600). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1089 Product name: Recombinant human EPB41L3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 191-312 aa of BC008377 Sequence: MQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGS Predict reactive species Full Name: erythrocyte membrane protein band 4.1-like 3 Calculated Molecular Weight: 121 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: BC008377 Gene Symbol: EPB41L3 Gene ID (NCBI): 23136 RRID: AB_3670945 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9Y2J2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.