Proteintech, 83296-4-RR, FGD6 Recombinant monoclonal antibody

Size: 20ul / 100ul The FGD6 (83296-4-RR) by Proteintech is a Recombinant antibody targeting FGD6 in WB, ELISA applications with reactivity to human samples 83296-4-RR targets FGD6 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, A549 cells, Jurkat cells, HeLa cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information FGD6, also known as ZFYVE24, is localized on the Homo sapiens chromosome 12q22 and consists of 1,400 amino acids. Previous studies have reported that variations in FGD6 increase individual susceptibility to polypoidal choroidal vasculopathy. It was also demonstrated that FGD6 coordinates cell polarity and endosomal membrane recycling in osteoclasts by regulating the assembly of different actin-based protein networks and activating Cdc42 at different locations. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22211 Product name: Recombinant human FGD6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 289-348 aa of BC013319 Sequence: ACSSNKYGLDYLKNQPARVCEHCFQELQKLDHQHSPRIGSPGNHKSPSSALSSVLHSIPS Predict reactive species Full Name: FYVE, RhoGEF and PH domain containing 6 Calculated Molecular Weight: 1430 aa, 161 kDa Observed Molecular Weight: 161 kDa GenBank Accession Number: BC013319 Gene Symbol: FGD6 Gene ID (NCBI): 55785 RRID: AB_3670963 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q6ZV73 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.