Iright
BRAND / VENDOR: Proteintech

Proteintech, 83302-1-RR, PGT Recombinant monoclonal antibody

CATALOG NUMBER: 83302-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PGT (83302-1-RR) by Proteintech is a Recombinant antibody targeting PGT in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 83302-1-RR targets PGT in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, mouse heart tissue Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Prostaglandin transporter (PGT), also known as SLCO2A1, has been identified as a functional prostaglandin (PG) carrier that mediates either the release of newly-synthesized PGs by cells and/or the uptake of PGs prior to intracellular oxidation. Northern blot analysis revealed that PGT mRNA has broad tissue distribution, suggesting its role in the transport and/ or metabolic clearance of PG in diverse tissues (PMID: 8787677,22331663). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5594 Product name: Recombinant human PGT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 422-643 aa of BC041140 Sequence: TPTVAEVYPPSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAHFLLPAIFLISFVSLIACISHNPLYMMVLRVVNQEEKSFAIGVQFLLMRLLAWLPSPALYGLTIDHSCIRWNSLCLGRRGACAYYDNDALRDRYLGLQMGYKALGMLLLCFISWRVKKNKEYNVQKAAGLI Predict reactive species Full Name: solute carrier organic anion transporter family, member 2A1 Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC041140 Gene Symbol: PGT Gene ID (NCBI): 6578 RRID: AB_3670971 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q92959 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924