Iright
BRAND / VENDOR: Proteintech

Proteintech, 83304-1-RR, GGT1 Recombinant monoclonal antibody

CATALOG NUMBER: 83304-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GGT1 (83304-1-RR) by Proteintech is a Recombinant antibody targeting GGT1 in WB, IHC, ELISA applications with reactivity to human samples 83304-1-RR targets GGT1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human kidney tissue Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information GGT1 is a transpeptidase whose activity increases the availability of amino acids, primarily cysteine, for intracellular GSH synthesis. GGT1 also plays a critical role in maintaining GSH homeostasis and defense against oxidative stress. In liver and obstructive biliary diseases, circulating GGT1 activity has widely been used for diagnosis purposes, as well as an indicator of alcohol consumption. (PMID: 31151999) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34209 Product name: Recombinant human GGT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-470 aa of NM_013430 Sequence: TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG Predict reactive species Full Name: gamma-glutamyltransferase 1 Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: NM_013430 Gene Symbol: GGT1 Gene ID (NCBI): 2678 RRID: AB_3670973 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P19440 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924