Iright
BRAND / VENDOR: Proteintech

Proteintech, 83319-1-RR, SAT1 Recombinant monoclonal antibody

CATALOG NUMBER: 83319-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SAT1 (83319-1-RR) by Proteintech is a Recombinant antibody targeting SAT1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 83319-1-RR targets SAT1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells, HeLa cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: RAW 264.7 cells Positive FC (Intra) detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Spermidine/spermine N1-acetyltransferase 1 (SAT1 or SSAT1) is the key regulatory enzyme in the catabolism of polyamines, catalyzing acetylation of spermidine or spermine to generate N1-acetyl spermidine or N1-acetyl spermine, and N1, N12-diacetylspermine. The cellular level of SAT1 is normally extremely low, but it is induced rapidly by a variety of stimuli, including polyamines, polyamine analogs, toxic chemicals, certain drugs, and growth factors. Downregulation of SAT1 has been reported in Epstein-Barr virus positive Burkitt's lymphoma cells. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1154 Product name: Recombinant human SAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC008424 Sequence: MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE Predict reactive species Full Name: spermidine/spermine N1-acetyltransferase 1 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 15-25 kDa GenBank Accession Number: BC008424 Gene Symbol: SAT1 Gene ID (NCBI): 6303 RRID: AB_3670985 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P21673 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924