Iright
BRAND / VENDOR: Proteintech

Proteintech, 83322-3-RR, AQP6 Recombinant monoclonal antibody

CATALOG NUMBER: 83322-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The AQP6 (83322-3-RR) by Proteintech is a Recombinant antibody targeting AQP6 in WB, ELISA applications with reactivity to human samples 83322-3-RR targets AQP6 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, HEK-293 cells, MCF-7 cells, U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information AQP6 (Aquaporin-6) has recently been identified as an intracellular vesicle water channel with anion permeability that is activated by low pH or HgCl2 (PMID: 12034750). It could be involved in physiological mechanisms of fluid movement, acid-base regulation, and/or anion transport. The calculated MW of AQP6 is 29 kDa, but the actual observed MW is around 35 kDa, which represents glycosylated AQP6 monomer forms (PMID: 19811639). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26845 Product name: Recombinant human AQP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 221-282 aa of NM_001652 Sequence: MLMGALLASLIYNFVLFPDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEMESV Predict reactive species Full Name: aquaporin 6, kidney specific Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: NM_001652 Gene Symbol: AQP6 Gene ID (NCBI): 363 RRID: AB_3670988 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q13520 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924