Iright
BRAND / VENDOR: Proteintech

Proteintech, 83414-5-RR, TBX20 Recombinant monoclonal antibody

CATALOG NUMBER: 83414-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TBX20 (83414-5-RR) by Proteintech is a Recombinant antibody targeting TBX20 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 83414-5-RR targets TBX20 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: H9C2 cells, mouse heart tissue, rat heart tisue Positive FC (Intra) detected in: k562 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Tbx20 is a transcription factor that is essential for proper heart development in a growing fetus. Any mutations in this gene can result in various forms of congenital heart disease. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18501 Product name: Recombinant human TBX20 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-119 aa of BC120946 Sequence: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTSLDAHGEFGGGSGSSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTE Predict reactive species Full Name: T-box 20 Calculated Molecular Weight: 297 aa, 33 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC120946 Gene Symbol: TBX20 Gene ID (NCBI): 57057 RRID: AB_3671063 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9UMR3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924