Proteintech, 83423-1-RR, IFIT1 Recombinant monoclonal antibody

Size: 20ul / 100ul The IFIT1 (83423-1-RR) by Proteintech is a Recombinant antibody targeting IFIT1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples 83423-1-RR targets IFIT1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: IFN alpha treated HeLa cells, SGC-7901 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information IFIT1, also known as glucocorticoid-attenuated response gene 16 protein (GARG-16), is a 463 amino acid protein belonging to the IFIT family. IFIT genes comprise a large family with three (IFIT1, IFIT2, and IFIT3) and four (IFIT1, IFIT2, IFIT3, and IFIT5) members in mice and humans, respectively. IFIT1 specifically bound virus PPP-RNA forms a complex with IFIT2 and IFIT3 to sequester the viral PPP-RNA and prevent virus replication. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19691 Product name: Recombinant human IFIT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 340-460 aa of BC007091 Sequence: EVAHLDLARMYIEAGNHRKAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSINSLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYY Predict reactive species Full Name: interferon-induced protein with tetratricopeptide repeats 1 Calculated Molecular Weight: 478 aa, 55 kDa Observed Molecular Weight: 55-65 kDa GenBank Accession Number: BC007091 Gene Symbol: IFIT1 Gene ID (NCBI): 3434 RRID: AB_3671072 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P09914 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.