Iright
BRAND / VENDOR: Proteintech

Proteintech, 83431-1-RR, PLK2 Recombinant monoclonal antibody

CATALOG NUMBER: 83431-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PLK2 (83431-1-RR) by Proteintech is a Recombinant antibody targeting PLK2 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83431-1-RR targets PLK2 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: hTERT-RPE1 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information PLK2(Polo-like kinase 2) is also named as SNK and belongs to the Ser/Thr protein kinase family. It plays a role in normal cell division. Plk2 expression is detected only in G1, and endogenous Plk2 is rapidly turned over. Therefore, the expression of the three mammalian Plks during the cell cycle resembles the successive transition of the cyclins, prompting speculation that Plks may reg-ulate the cell cycle in a manner analogous to that of Cdks(PMID:12972611). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29837 Product name: Recombinant human PLK2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 357-497 aa of BC013879 Sequence: SSPAKNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEADCIPKEQL Predict reactive species Full Name: polo-like kinase 2 (Drosophila) Calculated Molecular Weight: 685 aa, 78 kDa GenBank Accession Number: BC013879 Gene Symbol: PLK2 Gene ID (NCBI): 10769 RRID: AB_3671076 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9NYY3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924