Iright
BRAND / VENDOR: Proteintech

Proteintech, 83440-2-RR, TMEM126A Recombinant monoclonal antibody

CATALOG NUMBER: 83440-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TMEM126A (83440-2-RR) by Proteintech is a Recombinant antibody targeting TMEM126A in WB, IF/ICC, ELISA applications with reactivity to human samples 83440-2-RR targets TMEM126A in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: T-47D cells, HeLa cells, MCF-7 cells, U-251 cells, U2OS cells, human placenta tissue Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information TMEM126A is a mitochondrial inner membrane protein that is enriched in the cristae. TMEM126A is necessary for Complex I assembly or stability.Complex I (CI) is the largest enzyme of the mitochondrial respiratory chain, and its defects are the main cause of mitochondrial disease. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14705 Product name: Recombinant human TMEM126A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-195 aa of BC007875 Sequence: AGLPMAGIPFLTTDLTYRCFVSFPLNTGDLDCETCTITRSGLTGLVIGGLYPVFLAIPVNGGLAARYQSALLPHKGNILSYWIRTSKPVFRKMLFPILLQTMFSAYLGSEQYKLLIKALQLSEPGKEIH Predict reactive species Full Name: transmembrane protein 126A Calculated Molecular Weight: 195 aa, 22 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC007875 Gene Symbol: TMEM126A Gene ID (NCBI): 84233 RRID: AB_3671081 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H061 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924