Product Description
Size: 20ul / 100ul
The DENND6A (83473-3-RR) by Proteintech is a Recombinant antibody targeting DENND6A in WB, FC (Intra), ELISA applications with reactivity to human samples
83473-3-RR targets DENND6A in WB, FC (Intra), ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: PC-3 cells, HEK-293 cells
Positive FC (Intra) detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
FAM116A has DENN-related domains, which are required for cell migration.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag22052 Product name: Recombinant human FAM116A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC040291 Sequence: MALRGPAGLGPGSRRPLDEAVAGAEGREAPALVAAGGAPEDDEEDDGRGRGLLRWDSFSA Predict reactive species
Full Name: family with sequence similarity 116, member A
Calculated Molecular Weight: 608 aa, 70 kDa
Observed Molecular Weight: 61 kDa
GenBank Accession Number: BC040291
Gene Symbol: FAM116A
Gene ID (NCBI): 201627
RRID: AB_3671102
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q8IWF6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924