Iright
BRAND / VENDOR: Proteintech

Proteintech, 83488-4-RR, FAM38B Recombinant monoclonal antibody

CATALOG NUMBER: 83488-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The FAM38B (83488-4-RR) by Proteintech is a Recombinant antibody targeting FAM38B in WB, FC (Intra), ELISA applications with reactivity to human samples 83488-4-RR targets FAM38B in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information FAM38B, also named as PIEZO2, is a mechanosensitive, rapidly inactivating (RI) ion channel which is open and converts the mechanical stimulus signals into bioelectrical signals after stimulated by mechanical signals. FAM38B has been recently identified in dorsal root ganglion (DRG) neurons to mediate tactile transduction. It plays an important role in the biological process, maintaining cell metabolism and cell migration. Loss-of-function mutations in the human FAM38B gene cause an autosomal recessive syndrome of muscular atrophy with perinatal respiratory distress, arthrogryposis, and scoliosis.The 80 kDa band detected by SDS-PAGE can be caused by alternative splicing (PMID: 34335288, 37227654). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24528 Product name: Recombinant human FAM38B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 306-401 aa of AB527139 Sequence: KQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSEN Predict reactive species Full Name: family with sequence similarity 38, member B Calculated Molecular Weight: 318 kDa Observed Molecular Weight: 250-310 kDa, 80 kDa GenBank Accession Number: AB527139 Gene Symbol: FAM38B Gene ID (NCBI): 63895 RRID: AB_3671114 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H5I5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924