Iright
BRAND / VENDOR: Proteintech

Proteintech, 83511-1-RR, GPR105 Recombinant monoclonal antibody

CATALOG NUMBER: 83511-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GPR105 (83511-1-RR) by Proteintech is a Recombinant antibody targeting GPR105 in WB, ELISA applications with reactivity to human, mouse samples 83511-1-RR targets GPR105 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, MCF-7 cells, human placenta tissue, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information GPR105 (P2RY14) is widely expressed throughout many brain regions and peripheral tissues of humans and rodents, and couples to a pertussis toxin-sensitive G protein (PMID: 14559350). GPR105 is also prominently expressed in immune cells, including macrophages, lymphocytes, and neutrophils (PMID: 22778393). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14105 Product name: Recombinant human GPR105 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 249-338 aa of BC034989 Sequence: YHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL Predict reactive species Full Name: purinergic receptor P2Y, G-protein coupled, 14 Calculated Molecular Weight: 338 aa, 39 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC034989 Gene Symbol: P2RY14 Gene ID (NCBI): 9934 RRID: AB_3671136 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15391 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924