Proteintech, 83514-3-RR, Integrin beta 5 Recombinant monoclonal antibody

Size: 20ul / 100ul The Integrin beta 5 (83514-3-RR) by Proteintech is a Recombinant antibody targeting Integrin beta 5 in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples 83514-3-RR targets Integrin beta 5 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HT-29 cells, NIH-H1299 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information ITGB5, also known as Integrin beta-5. It is expected to be located in the plasma membrane and mitochondria, which is i ubiquitinated in placenta and gall bladder. ITGB5 is a member of integrins and was proved to be associated with pathological processes in several tumors (PMID: 34966851). It is reported that TGB5 is highly expressed in hepatocellular carcinoma (HCC), and miR-185 regulates the expression of β- catenin through the ITGB5-dependent manner and affects the proliferation and migration of HCC cells (PMID: 35223869). The molecular weight of ITGB5 is 88 kDa, and the glycosylation modification also exists. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29783 Product name: Recombinant human Integrin beta-5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-126 aa of BC006541 Sequence: GLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTF Predict reactive species Full Name: integrin, beta 5 Calculated Molecular Weight: 88 kDa Observed Molecular Weight: 88-100 kDa GenBank Accession Number: BC006541 Gene Symbol: Integrin beta 5 Gene ID (NCBI): 3693 RRID: AB_3671139 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P18084 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.