Iright
BRAND / VENDOR: Proteintech

Proteintech, 83546-3-RR, MBOAT7 Recombinant monoclonal antibody

CATALOG NUMBER: 83546-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MBOAT7 (83546-3-RR) by Proteintech is a Recombinant antibody targeting MBOAT7 in IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83546-3-RR targets MBOAT7 in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HuH-7 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information MBOAT7 (membrane-bound O-acyltransferase domain containing 7), also known as LPIAT, LENG4, or BB1, belongs to the MBOAT superfamily. MBOAT7 acylates lyso-phosphatidylinositol (lyso-PI) with arachidonyl-CoA and is involved in phosphatidylinositol acyl-chain remodeling in the Lands cycle (PMID: 30959108; PMID: 35509994). MBOAT7 deficiency in humans leads to developmental disorders of the central nervous system, with intellectual disability, epilepsy, and autism spectrum disorder (PMID: 37316513). The calculated molecular weight of MBOAT7 is 53 kDa. This antibody can recognize the 45 kDa isoform of MBOAT7. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24466 Product name: Recombinant human MBOAT7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 284-344 aa of BC006309 Sequence: SSPEKAASLEYDYETIRNIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLR Predict reactive species Full Name: membrane bound O-acyltransferase domain containing 7 Calculated Molecular Weight: 472 aa, 53 kDa GenBank Accession Number: BC006309 Gene Symbol: MBOAT7 Gene ID (NCBI): 79143 RRID: AB_3671165 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q96N66 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924