Proteintech, 83563-2-RR, RSAD2 Recombinant monoclonal antibody

Size: 20ul / 100ul The RSAD2 (83563-2-RR) by Proteintech is a Recombinant antibody targeting RSAD2 in WB, ELISA applications with reactivity to human samples 83563-2-RR targets RSAD2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, HUVEC cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6600 Background Information RSAD2 (radical S-adenosyl methionine domain-containing protein 2), also known as CIG5 (cytomegalovirus-induced gene 5 protein), vig1, viperin or CIG33, displays antiviral effect against HIV-1 virus, hepatitis C virus, human cytomegalovirus, and aphaviruses. Expression of the protein can be induced by interferon. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27733 Product name: Recombinant human RSAD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 181-361 aa of BC017969 Sequence: DSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW Predict reactive species Full Name: radical S-adenosyl methionine domain containing 2 Calculated Molecular Weight: 361 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC017969 Gene Symbol: RSAD2 Gene ID (NCBI): 91543 RRID: AB_3671178 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8WXG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.