Iright
BRAND / VENDOR: Proteintech

Proteintech, 83570-4-RR, ANAPC10 Recombinant monoclonal antibody

CATALOG NUMBER: 83570-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ANAPC10 (83570-4-RR) by Proteintech is a Recombinant antibody targeting ANAPC10 in IF/ICC, ELISA applications with reactivity to human samples 83570-4-RR targets ANAPC10 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information The anaphase promoting complex/cyclosome (APC/C) is a cell cycle-regulated multimeric E3 ubiquitin ligase assembled from 13 individual subunits. The anaphase promoting complex subunit 10 (APC10) is a core subunit of APC/C that is highly conserved in humans. APC10 genetically and physically interacts with a series of subunits of the APC/C and is necessary for the ubiquitination activity of APC/C by enhancing the affinity of the APC/C for its substrate. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8487 Product name: Recombinant human ANAPC10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-185 aa of BC005217 Sequence: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR Predict reactive species Full Name: anaphase promoting complex subunit 10 Calculated Molecular Weight: 185 aa, 21 kDa GenBank Accession Number: BC005217 Gene Symbol: ANAPC10 Gene ID (NCBI): 10393 RRID: AB_3671183 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9UM13 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924