Proteintech, 83574-3-RR, CD320 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD320 (83574-3-RR) by Proteintech is a Recombinant antibody targeting CD320 in WB, ELISA applications with reactivity to human samples 83574-3-RR targets CD320 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, K-562 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CD320, also known as 8D6, 8D6A or TCblR, is a single-pass type I membrane protein containing 2 LDL-receptor class A domains. Expressed abundantly on follicular dendritic cells (FDCs), CD320 has been shown to enhance proliferation of germinal center (GC) B cells. It is the receptor for cellular uptake of transcobalamin-bound cobalamin. Defects in CD320 are the cause of methylmalonic aciduria type TCblR (MMATC). CD320 has a calculated molecular mass of 29 kDa. This antibody raised against 84-280aa of human CD320 protein detects bands at 58 kDa and 60-70 kDa. The aberrant mobility of the protein by SDS-PAGE is probably caused by extensive complex glycosylation (PMID: 18779389; 23415653). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21445 Product name: Recombinant human CD320 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-229 aa of BC000668 Sequence: SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAY Predict reactive species Full Name: CD320 molecule Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC000668 Gene Symbol: CD320 Gene ID (NCBI): 51293 RRID: AB_3671186 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NPF0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.