Iright
BRAND / VENDOR: Proteintech

Proteintech, 83579-5-RR, SEMA3A Recombinant monoclonal antibody

CATALOG NUMBER: 83579-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SEMA3A (83579-5-RR) by Proteintech is a Recombinant antibody targeting SEMA3A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 83579-5-RR targets SEMA3A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SKOV-3 cells, PC-12 cells, C6 cells Positive IHC detected in: human ovary cancer tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information SEMA3A (Semaphorin 3A), a class-3 semaphorin signaling protein, is involved in cell signaling with PlexinA1 and Neuropilin-1 (NRP1) receptors and it is responsible for recruiting dendritic cells into lymphatics. It's widely expressed in different tissues (PMID:10766232). SEMA3A has been shown to exert osteoprotective effects, characterized by increasing bone formation while inhibiting the activation of osteoclast precursor cells (PMID:36598593). However, SEMA3A also modulates the immune system. SEMA3A expression in a myocardial infarct area enhances macrophage polarization and inhibits monocyte migration into the lesion area (PMID:28540528). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27173 Product name: Recombinant human SEMA3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-235 aa of BC111416 Sequence: ICTYIEIGHHPEDNIFKLENSHFENGRGKSPYDPKLLTASLLIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPKFISAHLISES Predict reactive species Full Name: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A Calculated Molecular Weight: 771 aa, 89 kDa Observed Molecular Weight: 89 kDa GenBank Accession Number: BC111416 Gene Symbol: SEMA3A Gene ID (NCBI): 10371 RRID: AB_3671192 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q14563 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924