Proteintech, 83584-3-RR, GLIPR1L1 Recombinant monoclonal antibody

Size: 20ul / 100ul The GLIPR1L1 (83584-3-RR) by Proteintech is a Recombinant antibody targeting GLIPR1L1 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 83584-3-RR targets GLIPR1L1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human testis tissue, mouse testis tissue Positive FC (Intra) detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14852 Product name: Recombinant human GLIPR1L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-233 aa of BC014603 Sequence: SKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFLLLRIF Predict reactive species Full Name: GLI pathogenesis-related 1 like 1 Calculated Molecular Weight: 242 aa, 27 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC014603 Gene Symbol: GLIPR1L1 Gene ID (NCBI): 256710 RRID: AB_3671198 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6UWM5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.