Proteintech, 83586-1-RR, LEFTY1 Recombinant monoclonal antibody

Size: 20ul / 100ul The LEFTY1 (83586-1-RR) by Proteintech is a Recombinant antibody targeting LEFTY1 in WB, ELISA applications with reactivity to Human, mouse, rat samples 83586-1-RR targets LEFTY1 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: rat heart tissue, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Lefty is a member of the transforming growth factor (TGF) β superfamily, which is implicated in left-right patterning during embryogenesis. The Lefty family is comprised of Lefty 1 and Lefty 2 in mouse, and Lefty A and Lefty B in humans. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4925 Product name: Recombinant human LEFTY1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-366 aa of BC027883 Sequence: EQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP Predict reactive species Full Name: left-right determination factor 1 Calculated Molecular Weight: 366 aa, 41 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC027883 Gene Symbol: LEFTY1 Gene ID (NCBI): 10637 RRID: AB_3671200 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O75610 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.