Proteintech, 83593-5-RR, Neurogranin Recombinant monoclonal antibody

Size: 20ul / 100ul The Neurogranin (83593-5-RR) by Proteintech is a Recombinant antibody targeting Neurogranin in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 83593-5-RR targets Neurogranin in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:1000-1:4000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Neurogranin (formerly designated p17, also known as Ng, RC3 and BICKS) belongs to the neurogranin family. It is a neuron-specific substrate for protein kinase C (PKC). It is a postsynaptic protein that is highly enriched in brain, with restricted expression in the cortex, striatum, hippocampus, thalamus, hypothalamus and olfactory bulb nuclei. Neurogranin binds calmodulin at low levels of calcium, thereby regulating calmodulin-dependent nitric oxide synthase. Neurogranin acts as a "third messenger" substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. It binds to calmodulin in the absence of calcium. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0676 Product name: Recombinant human NRGN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC002835 Sequence: MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD Predict reactive species Full Name: neurogranin (protein kinase C substrate, RC3) Calculated Molecular Weight: 7.6 kDa Observed Molecular Weight: 15-17 kDa GenBank Accession Number: BC002835 Gene Symbol: Neurogranin Gene ID (NCBI): 4900 RRID: AB_3671208 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q92686 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.