Iright
BRAND / VENDOR: Proteintech

Proteintech, 83600-2-RR, PD-L1/CD274 Recombinant monoclonal antibody

CATALOG NUMBER: 83600-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PD-L1/CD274 (83600-2-RR) by Proteintech is a Recombinant antibody targeting PD-L1/CD274 in WB, IF/ICC, IF-P, ELISA applications with reactivity to human samples 83600-2-RR targets PD-L1/CD274 in WB, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, IFN gamma treated A549 cells, human placenta tissue Positive IF-P detected in: human placenta tissue Positive IF/ICC detected in: MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information PD-L1, also known as CD274 or B7H1, stands for programmed cell death ligand 1. It is a type I transmembrane protein that is thought to repress immune responses by binding to its receptor (PD1), thus inhibiting T-cell activation, proliferation, and cytokine production. It contains V-like and C-like immunoglobulin domains. PD-L1 expression is regulated by various cytokines, such as TNF-α or LPS (ISSN: 1848-7718). Increased expression of this protein in certain types of cancers, e.g., renal cell carcinoma or colon cancer, correlates with poor prognosis.What is the molecular weight of PD-L1?Depending on the isoform, the calculated molecular weight of the protein varies between 20 and 33 kDa (176-290 aa).What are the isoforms of PD-L1?According to NCBI, three different isoforms have been identified. There are significant differences in the untranslated and protein coding regions.What is the subcellular localization and tissue specificity of PD-L1?It is predicted to localize in the plasma membrane of various cell types, with a particularly high expression in placental trophoblast and subsets of immune cells. High levels of PD-L1 protein have also been detected in lung and colon tissues.What is the function of PD-L1 in immune responses?PD-L1 is critical for the induction and maintenance of immune self-tolerance during infection or inflammation in normal tissues. The interaction of PD-L1 and its receptors is responsible for preventing auto-immune phenotypes and balancing the overall immune response in situations such as pregnancy or tissue allografts. The interaction between PD-L1 and PD-1 or B7.1 starts an inhibitory signaling cascade, which results in the decreased proliferation of antigen-specific T-cells and increased survival of regulatory T-cells (PMID: 15240681).How can PD-L1's implication in cancer be used as a drug target?In certain tumors, high expression of PD-L1 serves as a stop-sign to inhibit the recognition of cancer cells by T-cells (PMID: 23087408). The interaction between PD-L1 and its receptors (PD1 and B7.1) is a mechanism for the tumor to evade the host immune response (PMID: 29357948). Several mAbs have been developed to target that interaction and thus prevent the inactivation of cytotoxic T-cells by the tumor (PMIDs: 23890059, 18173375). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1114 Product name: Recombinant human PD-L1/CD274 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 19-238 aa of BC074984 Sequence: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER Predict reactive species Full Name: CD274 molecule Calculated Molecular Weight: 290 aa, 33 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC074984 Gene Symbol: PD-L1 Gene ID (NCBI): 29126 RRID: AB_3671214 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NZQ7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924