Iright
BRAND / VENDOR: Proteintech

Proteintech, 83603-4-RR, C11orf67 Recombinant monoclonal antibody

CATALOG NUMBER: 83603-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The C11orf67 (83603-4-RR) by Proteintech is a Recombinant antibody targeting C11orf67 in WB, ELISA applications with reactivity to human, mouse, rat samples 83603-4-RR targets C11orf67 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, L02 cells, MCF-7 cells, SKOV-3 cells, rat testis tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information C11orf67 is predicted to be involved in positive regulation of fat cell differentiation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14258 Product name: Recombinant human C11orf67 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC002752 Sequence: MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC Predict reactive species Full Name: chromosome 11 open reading frame 67 Calculated Molecular Weight: 122 aa, 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC002752 Gene Symbol: C11orf67 Gene ID (NCBI): 28971 RRID: AB_3671217 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H7C9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924