Proteintech, 83627-1-RR, Timp-3 Recombinant monoclonal antibody

Size: 20ul / 100ul The Timp-3 (83627-1-RR) by Proteintech is a Recombinant antibody targeting Timp-3 in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples 83627-1-RR targets Timp-3 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: human tonsillitis tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Timp-3 (TIMP metallopeptidase inhibitor 3), also known as SFD. It is expected to be located in extracellular space, and the protein is enriched in the placenta tissue and fat tissue. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation, and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy. TIMP-3 is expressed as an unglycosylated 24 kDa and glycosylated 29 kDa protein with inhibitory activity against interstitial collagenase, stromelysin-1, and gelatinases A and B (PMID:11827795). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34657 Product name: Recombinant human Timp-3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 168-211 aa of BC014277 Sequence: MLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP Predict reactive species Full Name: TIMP metallopeptidase inhibitor 3 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 24-33 kDa GenBank Accession Number: BC014277 Gene Symbol: TIMP3 Gene ID (NCBI): 7078 RRID: AB_3671240 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P35625 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.