Iright
BRAND / VENDOR: Proteintech

Proteintech, 83677-2-RR, PBRM1 Recombinant monoclonal antibody

CATALOG NUMBER: 83677-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PBRM1 (83677-2-RR) by Proteintech is a Recombinant antibody targeting PBRM1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 83677-2-RR targets PBRM1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, HeLa cellls, U2OS cells, NIH/3T3 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information PBRM1, also named hPB1 BAF180 and Polybromo-1D, acts as a negative regulator of cell proliferation. PBRM1 is the second major mutated clear cell RCC cancer gene after VHL. PBRM1 loss is associated with low grade features. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33623 Product name: Recombinant human PBRM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-306 aa of BC015323 Sequence: MGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRKINMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAEYEGMMGGYPPGLPPLQGPVDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAPGGSPYGQQVGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAESNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDLMLRDTLNIRQAYNLENV* Predict reactive species Full Name: polybromo 1 Calculated Molecular Weight: 180 kDa Observed Molecular Weight: 180-195 kDa GenBank Accession Number: BC015323 Gene Symbol: PBRM1 Gene ID (NCBI): 55193 RRID: AB_3671280 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q86U86 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924