Proteintech, 83678-3-RR, Alpha-1-microglobulin Recombinant monoclonal antibody

Size: 20ul / 100ul The Alpha-1-microglobulin (83678-3-RR) by Proteintech is a Recombinant antibody targeting Alpha-1-microglobulin in WB, FC (Intra), ELISA applications with reactivity to human samples 83678-3-RR targets Alpha-1-microglobulin in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma, human urine sample Positive FC (Intra) detected in: MCF-7 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Alpha 1 microglobulin, also known as HI30, is a 27-30 kDa glycoprotein, present in various body fluids. It belongs to the lipocalin superfamily of hydrophobic ligand-binding proteins forming an internal ligand-binding pocket. The protein acts as a mediator of bacterial adhesion to polymer surfaces and is involved in inhibiting renal lithogenesis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1127 Product name: Recombinant Human Alpha-1-microglobulin protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-203 aa of NM_001633.4 Sequence: GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRV Predict reactive species Full Name: alpha-1-microglobulin/bikunin precursor Calculated Molecular Weight: 39kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: NM_001633.4 Gene Symbol: Alpha 1 microglobulin Gene ID (NCBI): 259 RRID: AB_3671281 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P02760 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.