Iright
BRAND / VENDOR: Proteintech

Proteintech, 83685-4-RR, CHI3L1/YKL40 Recombinant monoclonal antibody

CATALOG NUMBER: 83685-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CHI3L1/YKL40 (83685-4-RR) by Proteintech is a Recombinant antibody targeting CHI3L1/YKL40 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83685-4-RR targets CHI3L1/YKL40 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: THP-1 cells Positive FC (Intra) detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Chitinase 3-like-1 (CHI3L1/YKL-40/CGP-39/GP-39/hCGP-39) is a protein secreted from restricted cell types including colonic epithelial cells (CECs) and macrophages. CHI3L1 is an inflammation-associated molecule, and its expression is enhanced in persons with colitis and colon cancer. CHI3L1 is a 40 kDa protein and is produced by restricted cell types, including colonic epithelial cells (CECs) and macrophages. CHI3L1 can be detected in the Golgi apparatus and the endoplasmic reticulum, but its major sites of action seems to be extracellular as a secreted protein. (PMID:21763261) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33123 Product name: Recombinant human CHI3L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 223-383 aa of BC008568 Sequence: FRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVGAPISGPGIPGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAMVWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT Predict reactive species Full Name: chitinase 3-like 1 (cartilage glycoprotein-39) Calculated Molecular Weight: 383 aa, 43 kDa Observed Molecular Weight: 40-43 kDa GenBank Accession Number: BC008568 Gene Symbol: CHI3L1 Gene ID (NCBI): 1116 RRID: AB_3671287 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P36222 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924