Proteintech, 83686-3-RR, TBK1 Recombinant monoclonal antibody

Size: 20ul / 100ul The TBK1 (83686-3-RR) by Proteintech is a Recombinant antibody targeting TBK1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 83686-3-RR targets TBK1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: 4T1 cells, HCT 116 cells, HeLa cells, C6 cells, HSC-T6 cells, RAW 264.7 cells, mouse kidney tissue, HepG2 cells, HEK-293 cells, Jurkat cells, NIH/3T3 cells Positive IHC detected in: human placenta tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TBK1, also named as tumor necrosis factor (TNF) receptor-associated factor NF-kB activator (TANK)-binding kinase 1 (TBK1), NF-kB-activating kinase (NAK), T2K, is a multimeric kinase that modulates inflammation and autophagy. It is a ubiquitously expressed serine-threonine kinase belonging to the 'noncanonical IkB kinases' (IKKs) recognized for its critical role in regulating type I IFN production (PMID: 27211305). And TBK1 is an important player in yet another critical cellular function, autophagy. This antibody is specific for TBK1. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28894 Product name: Recombinant human TBK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 316-576 aa of BC034950 Sequence: LQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLA Predict reactive species Full Name: TANK-binding kinase 1 Observed Molecular Weight: 84 kDa GenBank Accession Number: BC034950 Gene Symbol: TBK1 Gene ID (NCBI): 29110 RRID: AB_3671288 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9UHD2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.