Proteintech, 83687-4-RR, RAB1B Recombinant monoclonal antibody

Size: 20ul / 100ul The RAB1B (83687-4-RR) by Proteintech is a Recombinant antibody targeting RAB1B in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 83687-4-RR targets RAB1B in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A431 cells, CHO cells, A375 cells, NIH/3T3 cells, mouse liver tissue, rat liver tissue Positive IHC detected in: human ovary cancer tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Positive FC (Intra) detected in: U-251 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Ras-related protein Rab-1B (RAB1B) belongs to the small GTPase superfamily and Rab family. Rab1b, a GTPase regulating secretory transport, was recently associated with targeting proteins to LDs in a Drosophila RNAi screen. Rab1b recruits lipid-synthesizing enzymes, facilitating Lipid droplets (LDs) growth. The small GTPase Rab1b interacts with diacylglycerol acyltransferase 2 to facilitate its targeting to the surface of lipid droplets. (PMID: 38809969). Rab1b, an extensively studied and established master regulator of ER-to-Golgi transport. The mechanism of Rab1b's function is to promote ER to LD surface targeting of those triglyceride-synthesizing enzymes that can associate with the unique lipid monolayer comprising the LD surface (PMID: 38809969). Rab1b is a regulatory protein involved in both COPI and COPII transport (PMID: 17429068). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12197 Product name: Recombinant human RAB1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC071169 Sequence: MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC Predict reactive species Full Name: RAB1B, member RAS oncogene family Calculated Molecular Weight: 201 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC071169 Gene Symbol: RAB1B Gene ID (NCBI): 81876 RRID: AB_3671289 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9H0U4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.