Iright
BRAND / VENDOR: Proteintech

Proteintech, 83709-1-RR, ULBP2 Recombinant monoclonal antibody

CATALOG NUMBER: 83709-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ULBP2 (83709-1-RR) by Proteintech is a Recombinant antibody targeting ULBP2 in WB, IHC, ELISA applications with reactivity to human samples 83709-1-RR targets ULBP2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, Saos-2 cells, THP-1 cells, COLO 320 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information NKG2D is an activating cell surface receptor that is predominantly expressed on cytotoxic immune cells. NKG2D recognizes a wide range of ligands. In humans, the NKG2D ligand (NKG2DL) includes MICA, MICB, and six members of the ULBP family (ULBP1-6) (PMID: 29568297; 30813924). ULBPs are MHC class I-related molecules (PMID: 11239445). ULBP2 contains two Ig-like domains, the alpha-1 and alpha-2 domains characteristic of the MHC class I family, but lacks the alpha-3 domain. It can be expressed as either a transmembrane or GPI-linked protein, or released from the cell surface (PMID: 21224393; 24614922). ULBP2 binds and activates the NKG2D, mediating the recruitment and activation of NK cells. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0858 Product name: Recombinant Human ULBP2 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-217 aa of NM_025217.4 Sequence: GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS Predict reactive species Full Name: UL16 binding protein 2 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: NM_025217.4 Gene Symbol: ULBP2 Gene ID (NCBI): 80328 RRID: AB_3671312 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9BZM5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924