Iright
BRAND / VENDOR: Proteintech

Proteintech, 83710-1-RR, FHIT Recombinant monoclonal antibody

CATALOG NUMBER: 83710-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The FHIT (83710-1-RR) by Proteintech is a Recombinant antibody targeting FHIT in WB, IHC, ELISA applications with reactivity to human samples 83710-1-RR targets FHIT in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, HEK-293 cells, HL-60 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information The candidate tumor suppressor gene, FHIT(Fragile histidine triad protein), encompasses the common human chromosomal fragile site at 3p14.2, the hereditary renal cancer translocation breakpoint, and cancer cell homozygous deletions. Fhit hydrolyzes dinucleotide 5',5'''-P1,P3-triphosphate in vitro and mutation of a central histidine abolishes hydrolase activity(PMID:9391102). FHIT has a major role in regulating beta-catenin-mediated gene transcription. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4181 Product name: Recombinant human FHIT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC032336 Sequence: MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ Predict reactive species Full Name: fragile histidine triad gene Calculated Molecular Weight: 147 aa, 17 kDa Observed Molecular Weight: 15-17 kDa GenBank Accession Number: BC032336 Gene Symbol: FHIT Gene ID (NCBI): 2272 RRID: AB_3671313 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P49789 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924