Iright
BRAND / VENDOR: Proteintech

Proteintech, 83739-3-RR, Dectin-1/CLEC7A Recombinant monoclonal antibody

CATALOG NUMBER: 83739-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Dectin-1/CLEC7A (83739-3-RR) by Proteintech is a Recombinant antibody targeting Dectin-1/CLEC7A in WB, ELISA applications with reactivity to human, mouse samples 83739-3-RR targets Dectin-1/CLEC7A in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: THP-1 cells, HL-60 cells, mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Dectin-1, also known as CLEC7A or CD369, is a type II membrane receptor consisting of an extracellular C-terminal C-type lectin domain, a short stalk region, a single transmembrane domain and a short N-terminal cytoplasmic tail, which contains an immunoreceptor tyrosine-based activation motif (PMID: 10779524; 21612412). Dectin-1 is expressed on monocytes, macrophages, neutrophils, dendritic cells and a subpopulation of T cells (PMID: 12244185). Dectin-1 plays a role in the innate immune response. It functions as a pattern-recognition receptor and recognizes a variety of β-glucans from fungi, plants and bacteria. Dectin-1 may also participate in orchestrating the adaptive immune response (PMID: 21612412). The apparent molecular weight is larger than the calculated molecular weight due to glycosylation (PMID: 10779524). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1344 Product name: Recombinant Human Dectin-1 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 66-247 aa of NM_197947.3 Sequence: TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM Predict reactive species Full Name: C-type lectin domain family 7, member A Calculated Molecular Weight: 28kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: NM_197947.3 Gene Symbol: Dectin-1 Gene ID (NCBI): 64581 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BXN2-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924