Proteintech, 83839-2-RR, GOLGA5 Recombinant monoclonal antibody

Size: 20ul / 100ul The GOLGA5 (83839-2-RR) by Proteintech is a Recombinant antibody targeting GOLGA5 in WB, IHC, ELISA applications with reactivity to human samples 83839-2-RR targets GOLGA5 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells, HeLa cells, Jurkat cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information GOLGA5 (Golgin subfamily A member 5) maintains Golgi structure, and stimulates the formation of Golgi stacks and ribbons. Also, it is involved in intra-Golgi retrograde transport (PMID: 12538640; 15718469). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35031 Product name: Recombinant human GOLGA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 251-410 aa of BC023021 Sequence: RSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTLQERLHEADATLKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKYSDEKKRVDEL Predict reactive species Full Name: golgi autoantigen, golgin subfamily a, 5 Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 80-95 kDa GenBank Accession Number: BC023021 Gene Symbol: GOLGA5 Gene ID (NCBI): 9950 RRID: AB_3671422 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8TBA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.