Product Description
Size: 20ul / 100ul
The SLC31A1 (83844-6-RR) by Proteintech is a Recombinant antibody targeting SLC31A1 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples
83844-6-RR targets SLC31A1 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
Tested Applications
Positive IF/ICC detected in: HepG2 cells
Positive FC (Intra) detected in: HeLa cells
Recommended dilution
Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag26601 Product name: Recombinant human SLC31A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-67 aa of BC013611 Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG Predict reactive species
Full Name: solute carrier family 31 (copper transporters), member 1
Calculated Molecular Weight: 21 kDa
GenBank Accession Number: BC013611
Gene Symbol: SLC31A1
Gene ID (NCBI): 1317
RRID: AB_3671430
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purfication
UNIPROT ID: O15431
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924