Proteintech, 83844-6-RR, SLC31A1 Recombinant monoclonal antibody

Size: 20ul / 100ul The SLC31A1 (83844-6-RR) by Proteintech is a Recombinant antibody targeting SLC31A1 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83844-6-RR targets SLC31A1 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26601 Product name: Recombinant human SLC31A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-67 aa of BC013611 Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG Predict reactive species Full Name: solute carrier family 31 (copper transporters), member 1 Calculated Molecular Weight: 21 kDa GenBank Accession Number: BC013611 Gene Symbol: SLC31A1 Gene ID (NCBI): 1317 RRID: AB_3671430 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O15431 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.