Proteintech, 83846-1-RR, USP53 Recombinant monoclonal antibody

Size: 20ul / 100ul The USP53 (83846-1-RR) by Proteintech is a Recombinant antibody targeting USP53 in WB, IHC, ELISA applications with reactivity to human samples 83846-1-RR targets USP53 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, A431 cells, HeLa cells, HepG2 cells Positive IHC detected in: rat liver tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Ubiquitin specific peptidase 53 (USP53) was originally discovered in cholestasis, and its tumor suppressive effects have recently been reported in various cancers. Zhao et al. showed that USP53 interacted with FKBP51 in lung adenocarcinoma cells, and induced apoptosis via the AKT pathway. Furthermore, USP53 inhibited the progression of clear cell renal cell carcinoma by suppressing the nuclear factor κB (NF‐κB) pathway. (PMID: 35654790) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28923 Product name: Recombinant human USP53 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 371-600 aa of NM_019050 Sequence: YKSVAENMGCEKPVIHKSDNLKENGFGDQAKQRENQKFPTDNISSSNRSHSHTGVGKGPAKLSHIDQREKIKDISRECALKAIEQKNLLSSQRKDLEKGQRKDLGRHRDLVDEDLSHFQSGSPPAPNGFKQHGNPHLYHSQGKGSYKHDRVVPQSRASAQIISSSKSQILAPGEKITGKVKSDNGTGYDTDSSQDSRDRGNSCDSSSKSRNRGWKPMRETLNVDSIFSES Predict reactive species Full Name: ubiquitin specific peptidase 53 Calculated Molecular Weight: 121 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: NM_019050 Gene Symbol: USP53 Gene ID (NCBI): 54532 RRID: AB_3671432 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q70EK8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.