Proteintech, 83887-4-RR, Tissue Factor/CD142 Recombinant monoclonal antibody

Size: 20ul / 100ul The Tissue Factor/CD142 (83887-4-RR) by Proteintech is a Recombinant antibody targeting Tissue Factor/CD142 in WB, ELISA applications with reactivity to human, mouse, rat samples 83887-4-RR targets Tissue Factor/CD142 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, mouse brain tissue, SH-SY5Y cells, NIH/3T3 cells, rat skin tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Normal blood coagulation is a complex process, involving a cascade of activation of different plasma proteins, ultimately resulting in the formation of a clot, called fibrin. Tissue Factor (TF), also named Coagulation factor III or F3, is the primary initiator of the blood coagulation cascade and plays an essential role in hemostasis (PMID: 26877187; PMID: 33796108). This antibody is specific for mouse Tissue Factor. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1102 Product name: Recombinant Mouse Tissue Factor protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 29-251 aa of Sequence: AGIPEKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKNKCFSTTDTECDLTDEIVKDVTWAYEAKVLSVPRRNSVHGDGDQLVIHGEEPPFTNAPKFLPYRDTNLGQPVIQQFEQDGRKLNVVVKDSLTLVRKNGTFLTLRQVFGKDLGYIITYRKGSSTGKKTNITNTNEFSIDVEEGVSYCFFVQAMIFSRKTNQNSPGSSTVCTEQWKSFLGE Predict reactive species Full Name: coagulation factor III Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 48-53 kDa Gene Symbol: Tissue Factor Gene ID (NCBI): 14066 RRID: AB_3671470 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P20352 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.