Iright
BRAND / VENDOR: Proteintech

Proteintech, 83892-3-RR, PHF19 Recombinant monoclonal antibody

CATALOG NUMBER: 83892-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PHF19 (83892-3-RR) by Proteintech is a Recombinant antibody targeting PHF19 in WB, FC (Intra), ELISA applications with reactivity to human samples 83892-3-RR targets PHF19 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, HeLa cells, HEK-293T cells, NCCIT cells, U-251 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information PHD FINGER PROTEIN 19(PHF19), a protein homologous to the Drosophila 'Polycomblike' (Pcl) protein, encoded by human gene PCL, which encodes 2 deduced proteins: a short form of 207 aa and a long form of 580 aa. The PCL family proteins contains a PCL homology domain, a Tudor domain, 2 PHD fingers and a C-terminal tail. It is highly expressed in thymus and heart, while 508aa form predominant in placenta, skeletal muscle and kidney and 207aa form in liver and peripheral blood leukocytes. Both of these forms can inhibit transcriptional activity. And the long form is corelated with cancer.Acts as a transcritpional repressor. The mRNA level of PHF19 is low in many normal tissue, it's elevated in cancer-derived cell lines. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2511 Product name: Recombinant human PHF19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC022374 Sequence: MENRALDPGTRDSYGATSHLPNKGALAKVKNNFKDLMSKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCGLGYHQQCHIPIAGSADQPLLTPWFCRRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALETDSASATVLGQDL Predict reactive species Full Name: PHD finger protein 19 Calculated Molecular Weight: 580 aa, 63 kDa Observed Molecular Weight: 62-66 kDa GenBank Accession Number: BC022374 Gene Symbol: PHF19 Gene ID (NCBI): 26147 RRID: AB_3671475 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5T6S3-2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924