Proteintech, 83908-3-RR, B7-H6 Recombinant monoclonal antibody

Size: 20ul / 100ul The B7-H6 (83908-3-RR) by Proteintech is a Recombinant antibody targeting B7-H6 in WB, ELISA applications with reactivity to human samples 83908-3-RR targets B7-H6 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, K-562 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information B7-H6, also known as NCR3LG1, is a member of the B7 family of immunoreceptors. It is a 454-aa-long type I transmembrane protein consisting of an extracellular region, a transmembrane segment, and a cytoplasmic domain which contains an immunoreceptor tyrosine-based inhibitory motif (ITIM), an SH2-binding domain, and an SH3-binding motif. B7-H6 triggers NKp30-mediated activation of human NK cells (PMID: 19528259). It has been reported that B7H6 is expressed in various types of tumor cells and plays a prominent role in natural killer cell immunosurveillance (PMID: 35697295). The apparent molecular weight of B7-H6 is larger than the calculated molecular weight of 51 kDa due to glycosylation (PMID: 19528259). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0007 Product name: Recombinant Human B7-H6 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 25-262 aa of BC136800 Sequence: DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS Predict reactive species Full Name: hypothetical protein DKFZp686O24166 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 75-80 kDa GenBank Accession Number: BC136800 Gene Symbol: B7H6 Gene ID (NCBI): 374383 RRID: AB_3671488 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q68D85 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.