Iright
BRAND / VENDOR: Proteintech

Proteintech, 83909-4-RR, ZFP161 / ZBTB14 Recombinant monoclonal antibody

CATALOG NUMBER: 83909-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ZFP161 / ZBTB14 (83909-4-RR) by Proteintech is a Recombinant antibody targeting ZFP161 / ZBTB14 in WB, FC (Intra), ELISA applications with reactivity to human samples 83909-4-RR targets ZFP161 / ZBTB14 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, L02 cells, Daudi cells, Jurkat cells, K-562 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information ZBTB14, also named as :ZFP161, ZNF478, is a 449 amino acid protein, which interacts with ZBTB21. ZBTB14, is a transcriptional activator of the dopamine transporter (DAT), binding it's promoter at the consensus sequence 5'-CCTGCACAGTTCACGGA-3'. ZBTB14 Binds to 5'-d(GCC)(n)-3' trinucleotide repeats in promoter regions and acts as a repressor of the FMR1 gene. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag16125 Product name: Recombinant human ZFP161 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 103-449 aa of BC110519 Sequence: EDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPSAIQSETEQLQAAAMAAEAEQQLETIACS Predict reactive species Full Name: zinc finger protein 161 homolog (mouse) Calculated Molecular Weight: 449 aa, 51 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC110519 Gene Symbol: ZFP161 Gene ID (NCBI): 7541 RRID: AB_3671490 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O43829 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924