Proteintech, 83921-3-RR, FAM185A Recombinant monoclonal antibody

Size: 20ul / 100ul The FAM185A (83921-3-RR) by Proteintech is a Recombinant antibody targeting FAM185A in WB, IHC, ELISA applications with reactivity to human samples 83921-3-RR targets FAM185A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-29 cells Positive IHC detected in: human ovarian cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15041 Product name: Recombinant human FAM185A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC029175 Sequence: MLAPCSGWELGCFRLCLRQVRLWAGAGRWACWACQARPYSSGGSERWPGSETEVPPPGPARRTLKEWTLQVSPFGRLRARLPCHLAVRPLDPLTYPDGDRVLVAVCGVEGGVRGLDGLQVKYDEDLEEMAIVSDTIHPQASVEV Predict reactive species Full Name: family with sequence similarity 185, member A Calculated Molecular Weight: 393 aa, 42 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC029175 Gene Symbol: FAM185A Gene ID (NCBI): 222234 RRID: AB_3671501 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8N0U4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.