Proteintech, 83931-1-RR, CLSTN3 Recombinant monoclonal antibody

Size: 20ul / 100ul The CLSTN3 (83931-1-RR) by Proteintech is a Recombinant antibody targeting CLSTN3 in WB, ELISA applications with reactivity to human, rat samples 83931-1-RR targets CLSTN3 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat brain tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Calsyntenins, also called alcadeins, are cadherin superfamily proteins first identified as synaptic proteins (PMID: 11161476; 12498782). Calsyntenins are type I transmembrane proteins with extracellular domains containing two cadherin repeats and an LNS (laminin, neurexin, sex hormone-binding globulin) domain (PMID: 24613359). Calsyntenin-3 (CLSTN3, also known as alcadein-beta) is a synapse-organizing protein that promotes the development of synapses. It is a postsynaptic adhesion molecule that binds to presynaptic neurexins to mediate both excitatory and inhibitory synapse formation (PMID: 25352602; 24613359). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14897 Product name: Recombinant human CLSTN3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 206-289 aa of BC039075 Sequence: VLGLVRIHSLHRRVSGAGGPPGASSDPKDPDLFWDDSALTIIVNPMEVRGLGKRGSVGSRLWSTHVLPESAVLCDGGCWGPAGG Predict reactive species Full Name: calsyntenin 3 Calculated Molecular Weight: 968 aa, 107 kDa Observed Molecular Weight: 130 kDa, 140 kDa GenBank Accession Number: BC039075 Gene Symbol: CLSTN3 Gene ID (NCBI): 9746 RRID: AB_3671512 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9BQT9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.