Iright
BRAND / VENDOR: Proteintech

Proteintech, 83939-2-RR, RAB11FIP5 Recombinant monoclonal antibody

CATALOG NUMBER: 83939-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RAB11FIP5 (83939-2-RR) by Proteintech is a Recombinant antibody targeting RAB11FIP5 in WB, ELISA applications with reactivity to human samples 83939-2-RR targets RAB11FIP5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Rab11 family-interacting protein 5 (Rab11fip5) is an adaptor protein that binds to the small GTPase Rab11, which has an important function in endosome recycling and trafficking of cellular proteins to the plasma membrane. Rab11fip5 is involved in many cellular processes, such as cytoskeleton rearrangement, iron uptake and exocytosis in neuroendocrine cells, and is also known as a candidate gene for autism-spectrum disorder. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6128 Product name: Recombinant human RAB11FIP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-250 aa of BC035013 Sequence: MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQVGREKYSTSVVEKTHGCPEWREECSFELPPGALDGLLRAQEADAGPAPWAASSAAACELVLTTMHRSLIGVDKFLGQATVALDEVFGAGRAQHTQWYKLHSKPGKKEKERGEIEVTIQFTRNNLSAMFDLSMKDKPRSPFSKIRDKMKGKKKYDLESASAILPSSAIEDPDLGSLGKMGKAKGFFLRNKLRKSSLTQSNTS Predict reactive species Full Name: RAB11 family interacting protein 5 (class I) Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC035013 Gene Symbol: RAB11FIP5 Gene ID (NCBI): 26056 RRID: AB_3671520 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BXF6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924