Iright
BRAND / VENDOR: Proteintech

Proteintech, 83945-5-RR, EOMES/TBR2 Recombinant monoclonal antibody

CATALOG NUMBER: 83945-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The EOMES/TBR2 (83945-5-RR) by Proteintech is a Recombinant antibody targeting EOMES/TBR2 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 83945-5-RR targets EOMES/TBR2 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NK-92 cells Positive IF/ICC detected in: SH-SY5Y cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information EOMES/TRB2 (also named Eomesodermin/Tbr2) encode T-box transcription factor expressed highly in the intermediate progenitor stage of the developing neuron. During migration of the neurons, radial glia divide and migrate towards the surface of the cerebral cortex, there are three stages of cellular development: radial glia, intermediate progenitors, and postmitotic projection neurons. Radial glia express Pax6, while intermediate progenitor cells express Eomesodermin/Tbr2, and postmitotic projection neurons express Tbr1 (PMID:15634788; PMID:16320258). This process also called neurogenesis, and demonstrated that Eomesodermin/Tbr2 has been implicated in neurodevelopment. According to the mouse model, several articles showed that EOMES/TRB2 KO mice having proliferating cells decreased and having smaller upper cortical layers and a smaller sub ventricular zone in the brain (PMID:18940588). What's more, Eomesodermin/Tbr2 has also been found participating in immune response (PMID:20713880). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27634 Product name: Recombinant human EOMES protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 575-676 aa of NM_001278182 Sequence: MWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGM Predict reactive species Full Name: eomesodermin homolog (Xenopus laevis) Calculated Molecular Weight: 73 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: NM_001278182 Gene Symbol: EOMES Gene ID (NCBI): 8320 RRID: AB_3671525 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O95936 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924