Proteintech, 83954-1-RR, PYROXD2 Recombinant monoclonal antibody

Size: 20ul / 100ul The PYROXD2 (83954-1-RR) by Proteintech is a Recombinant antibody targeting PYROXD2 in WB, ELISA applications with reactivity to human samples 83954-1-RR targets PYROXD2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, LNCaP cells, U-251 cells, A375 cells, L02 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Pyridine Nucleotide-Disulfide Oxidoreductase Domain 2 (PYROXD2, previously called YueF, C10orf33) is a mitochondrial inner membrane/matrix-residing protein and is reported to regulate mitochondrial function. PYROXD2 is highly expressed in the cytoplasm of normal cells and tissues but is expressed at lower levels in corresponding cancer cells, including liver, lung and renal cell carcinoma and bladder cancer cells (PMID: 29048625, PMID: 35606887). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14701 Product name: Recombinant human C10orf33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 232-581 aa of BC006131 Sequence: DQWFESEPLKATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGMQGAWGYVQGGMGALSDAIASSATTHGASIFTEKTVAKVQVNSEGCVQGVVLEDGTEVRSKMVLSNTSPQITFLKLTPQEWLPEEFLERISQLDTRSPVTKINVAVDRLPSFLAAPNAPRGQPLPHHQCSIHLNCEDTLLLHQAFEDAMDGLSSHRPVIELCIPSSLDPTLAPPGCHVVSLFTQYTPYTLAGGKAWDEQERDAYADRVFDCIEVYAPGFKDSVVGRDILTPPDLERIFGLPGGNIFHCAMSLDQLYFARPVPLHSGYRCPLQGLYLCGSGAHPGGGVMGAAGRNAAHVAFRDLKSM Predict reactive species Full Name: chromosome 10 open reading frame 33 Calculated Molecular Weight: 581 aa, 63 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC006131 Gene Symbol: PYROXD2 Gene ID (NCBI): 84795 RRID: AB_3671533 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N2H3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.