Proteintech, 83958-2-RR, PEA15 Recombinant monoclonal antibody

Size: 20ul / 100ul The PEA15 (83958-2-RR) by Proteintech is a Recombinant antibody targeting PEA15 in WB, ELISA applications with reactivity to human, mouse, rat samples 83958-2-RR targets PEA15 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C6 cells, COLO 320 cells, Neuro-2a cells, SH-SY5Y cells, U-87 MG cells, fetal human brain tissue, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Phosphoprotein Enriched in Astrocytes 15 kDa (PEA15), also known as PED-15, is a small, death effector-domain (DED)-containing protein that was recently demonstrated to inhibit tumor necrosis factor-α-induced apoptosis and to reverse the inhibition of integrin activation due to H-Ras. PEA15 is a 15 kDa protein that is highly expressed in the nervous system with particularly high levels in astrocytes and neurons of the hippocampus. PEA15 is a cytoplasmic protein that sits at an important junction in intracellular signalling and can regulate diverse cellular processes, such as proliferation and apoptosis, dependent upon stimulation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13782 Product name: Recombinant human PEA15 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-130 aa of BC002426 Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA Predict reactive species Full Name: phosphoprotein enriched in astrocytes 15 Calculated Molecular Weight: 130 aa, 15 kDa Observed Molecular Weight: 13-15 kDa GenBank Accession Number: BC002426 Gene Symbol: PEA15 Gene ID (NCBI): 8682 RRID: AB_3671535 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15121 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.