Proteintech, 83965-4-RR, SLPI Recombinant monoclonal antibody

Size: 20ul / 100ul The SLPI (83965-4-RR) by Proteintech is a Recombinant antibody targeting SLPI in WB, IHC, ELISA applications with reactivity to human samples 83965-4-RR targets SLPI in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human saliva, PC-3 cells Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information SLPI, a member of Whey acidic protein family, could mediate a variety of biological processes including cell proliferation and apoptosis, repairing reaction and immune response, with crucial roles in anti-protease, anti-inflammatory, anti-bacterial and anti-virus. SLPI is mainly expressed in epithelial cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1673 Product name: Recombinant human SLPI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC020708 Sequence: MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA Predict reactive species Full Name: secretory leukocyte peptidase inhibitor Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC020708 Gene Symbol: SLPI Gene ID (NCBI): 6590 RRID: AB_3671543 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P03973 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.